PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G14390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 332aa    MW: 35944.1 Da    PI: 6.9823
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G14390.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.96.1e-10137184552
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                      kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  LPERR03G14390.1 137 KRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLF 184
                      9****************************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-14133197IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.588135198IPR004827Basic-leucine zipper domain
PfamPF001701.1E-8137185IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.44E-11137188No hitNo description
Gene3DG3DSA:1.20.5.1708.7E-8137182No hitNo description
CDDcd147034.11E-22138187No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MQEPKPADPA SAAMRGGTHH RRARSEVAFR LPDDLDLGGG GAGGFDEIGS EDDLFSTFMD  60
IEKISSGPAA AAGGDRDRAA ETSSPPRPKH RHSSSVDGSG FFAAARKDAA ASLAEVMEAK  120
KAMTPEQLAE LAAIDPKRAK RILANRQSAA RSKERKARYI TELERKVQTL QTEATTLSAQ  180
LTLFQRDTTG LSTENAELKI RLQAMEQQAQ LRDALNDALK QELERLKLAT GEMTNSNETY  240
SMGLQHVPYN TPFFPLSQQS TARQNGGAQL PAQFQPPRPN MPNHMLSHPN GLHDIMQQDP  300
LGRLQGLDIS KGPPVVKSES SSISASESSS TF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0594730.0AK059473.1 Oryza sativa Japonica Group cDNA clone:001-028-E05, full insert sequence.
GenBankAK0704660.0AK070466.1 Oryza sativa Japonica Group cDNA clone:J023052D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632816.10.0PREDICTED: transcription factor RF2b
SwissprotQ6S4P40.0RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0D9VTR60.0A0A0D9VTR6_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g21800.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.18e-79bZIP family protein